PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g081120.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 355aa    MW: 39654.6 Da    PI: 6.0029
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g081120.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-092843162355
                         SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         +yps++++  LA+++gL+++q+ +WF N+R ++
  Sopim02g081120.0.1 284 PYPSESQKLALAESTGLDQKQINNWFINQRKRH 316
                         8*****************************885 PP

2ELK41.23.6e-14236257122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLlrKYsgyLgsLkqEF+
  Sopim02g081120.0.1 236 ELKGQLLRKYSGYLGSLKQEFM 257
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-1993137IPR005540KNOX1
PfamPF037902.6E-2295134IPR005540KNOX1
SMARTSM012564.7E-26146197IPR005541KNOX2
PfamPF037912.6E-21150196IPR005541KNOX2
SMARTSM011882.8E-8236257IPR005539ELK domain
PROSITE profilePS5121311.174236256IPR005539ELK domain
PfamPF037895.8E-11236257IPR005539ELK domain
PROSITE profilePS5007112.827256319IPR001356Homeobox domain
SMARTSM003891.3E-11258323IPR001356Homeobox domain
SuperFamilySSF466891.45E-19258333IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27261321IPR009057Homeodomain-like
CDDcd000865.55E-12268320No hitNo description
PfamPF059201.5E-17276315IPR008422Homeobox KN domain
PROSITE patternPS000270294317IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEGGSSGNTS TSCLMMMGYG DHENNNNNNG NGNGNGNGNV TICAPPMMMM MPPPPPSLTN  60
NNNAETSSNN ILFLPFMDNN NNNPQEDNNS SSSSIKSKIM AHPHYHRLLT AYLNCQKIGA  120
PPEVVARLEE ICATSATMGR SSSSSGGGII GEDPALDQFM EAYCEMLTKY EQELSKPFKE  180
AMVFLSRIEC QFKALTLAPN SSHESALGEA MDRNGSSDEE VDVNNSFIDP QAEDRELKGQ  240
LLRKYSGYLG SLKQEFMKKR KKGKLPKEAR QQLVDWWLRH IKWPYPSESQ KLALAESTGL  300
DQKQINNWFI NQRKRHWKPS EDMQFVVMDA AHPHYYMDNV LANHFPMDMT PSLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251260LKQEFMKKRK
2257261KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLEU764070.0U76407.1 Lycopersicon esculentum knotted 2 protein (TKn2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233941.20.0homeobox protein knotted-1-like LET6
SwissprotO222990.0LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLK4B9Y20.0K4B9Y2_SOLLC; Uncharacterized protein
STRINGSolyc02g081120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-129KNOX/ELK homeobox transcription factor